Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WASF3/WAVE3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP154992
Description
WASF3/WAVE3 Polyclonal specifically detects WASF3/WAVE3 in Human, Chicken samples. It is validated for Western Blot.Specifications
WASF3/WAVE3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
KIAA0900WASP family Verprolin-homologous protein 3, Protein WAVE-3, SCAR3WASP family protein member 3, Verprolin homology domain-containing protein 3, WAS protein family, member 3, WAVE3Brush-1, wisk | |
Rabbit | |
55 kDa | |
100 μL | |
Stem Cell Markers | |
10810 | |
Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9UPY6 | |
WASF3 | |
Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the N terminal of WASF3. Peptide sequence NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction