Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WASF3/WAVE3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP154992 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154992 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154992 Supplier Novus Biologicals Supplier No. NBP154992
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

WASF3/WAVE3 Polyclonal specifically detects WASF3/WAVE3 in Human, Chicken samples. It is validated for Western Blot.

Specifications

Antigen WASF3/WAVE3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UPY6
Gene Alias KIAA0900WASP family Verprolin-homologous protein 3, Protein WAVE-3, SCAR3WASP family protein member 3, Verprolin homology domain-containing protein 3, WAS protein family, member 3, WAVE3Brush-1, wisk
Gene Symbols WASF3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the N terminal of WASF3. Peptide sequence NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10810
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Chicken, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.