Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WBP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | WBP4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WBP4 Polyclonal specifically detects WBP4 in Human samples. It is validated for Western Blot.Specifications
WBP4 | |
Polyclonal | |
Rabbit | |
NP_009118 | |
11193 | |
Synthetic peptide directed towards the N terminal of human WBP4. Peptide sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQK | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
domain-containing binding protein 4, WW domain binding protein 4 (formin binding protein 21) | |
WBP4 | |
IgG | |
42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title