Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WDFY2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$366.50 - $607.50

Specifications

Antigen	WDFY2
Dilution	Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Applications	Western Blot, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB169986 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31745525UL	25 μg	Each for $366.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB169985 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP317455100UL	100 μg	Each for $607.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

WDFY2 Polyclonal antibody specifically detects WDFY2 in Human samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen	WDFY2
Applications	Western Blot, Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Signal Transduction
Formulation	PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)	115825
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	propeller-FYVE protein, RP11-147H23.1, WD repeat and FYVE domain containing 2, WD repeat and FYVE domain-containing protein 2, WD40 and FYVE domain containing 2, WD40- and FYVE domain-containing protein 2, WDF2, ZFYVE22PROF, Zinc finger FYVE domain-containing protein 22
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: VCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDM
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

WDFY2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents