Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR33 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR33 Polyclonal specifically detects WDR33 in Human samples. It is validated for Western Blot.Specifications
WDR33 | |
Polyclonal | |
Rabbit | |
Q6NUQ0 | |
55339 | |
Synthetic peptides corresponding to WDR33(WD repeat domain 33) The peptide sequence was selected from the middle region of WDR33. Peptide sequence TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
NET14, WD repeat domain 33, WD repeat-containing protein 33, WD repeat-containing protein WDC146, WDC146FLJ11294 | |
WDR33 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title