Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR49 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR49 Polyclonal specifically detects WDR49 in Human samples. It is validated for Western Blot.Specifications
WDR49 | |
Polyclonal | |
Rabbit | |
WD repeat domain 49 | |
WDR49 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
151790 | |
Synthetic peptides corresponding to WDR49(WD repeat domain 49) The peptide sequence was selected from the C terminal of WDR49. Peptide sequence ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title