Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR54 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR54 Polyclonal specifically detects WDR54 in Human samples. It is validated for Western Blot.Specifications
WDR54 | |
Polyclonal | |
Rabbit | |
NP_115494 | |
84058 | |
Synthetic peptide directed towards the C terminal of human WDR54The immunogen for this antibody is WDR54. Peptide sequence HVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ12953, WD repeat domain 54, WD repeat-containing protein 54 | |
WDR54 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title