Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR57 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19258525UL
Description
WDR57 Polyclonal specifically detects WDR57 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
WDR57 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated | |
38 kDa-splicing factor, HPRP8BP, Prp8-binding protein, PRP8BP40K, PRPF8BPFLJ41108, RP11-490K7.3, SFP38, small nuclear ribonucleoprotein 40kDa (U5), SPF38MGC1910, U5 small nuclear ribonucleoprotein 40 kDa protein, U5 snRNP 40 kDa protein, U5 snRNP-specific 40 kDa protein, U5 snRNP-specific 40 kDa protein (hPrp8-binding), U5-40K, U5-40kD protein, WD repeat domain 57 (U5 snRNP specific), WD repeat-containing protein 57, WDR57 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human WDR57 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SNRNP40 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ | |
25 μL | |
Core ESC Like Genes, Stem Cell Markers | |
9410 | |
Human, Mouse, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction