Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15484420UL
Description
WDR6 Polyclonal specifically detects WDR6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
WDR6 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q6AZD6 | |
WDR6 | |
Synthetic peptides corresponding to WDR6 (WD repeat domain 6) The peptide sequence was selected from the C terminal of WDR6. Peptide sequence TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE. | |
Affinity Purified | |
RUO | |
11180 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
FLJ10218, FLJ52552, FLJ56107, MGC126756, MGC142027, WD repeat domain 6, WD repeat-containing protein 6 | |
Rabbit | |
53 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction