Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR63 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR63 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR63 Polyclonal specifically detects WDR63 in Human samples. It is validated for Western Blot.Specifications
WDR63 | |
Polyclonal | |
Rabbit | |
Q8IWG1 | |
126820 | |
Synthetic peptides corresponding to WDR63(WD repeat domain 63) The peptide sequence was selected from the middle region of WDR63. Peptide sequence EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ30067, NYD-SP29, RP11-507C22.2, Testis development protein NYD-SP29, testis development protein NYD-SP29 (NYD-SP29), WD repeat domain 63, WD repeat-containing protein 63 | |
WDR63 | |
IgG | |
103 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title