WDR63 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156718

Catalog No. NBP156718

Description

WDR63 Polyclonal specifically detects WDR63 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WDR63
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IWG1
• Gene Symbols: WDR63
• Immunogen: Synthetic peptides corresponding to WDR63(WD repeat domain 63) The peptide sequence was selected from the middle region of WDR63. Peptide sequence EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126820
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ30067, NYD-SP29, RP11-507C22.2, Testis development protein NYD-SP29, testis development protein NYD-SP29 (NYD-SP29), WD repeat domain 63, WD repeat-containing protein 63
• Host Species: Rabbit
• Molecular Weight of Antigen: 103 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG