WDR79 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256099

Catalog No. NBP256099

Description

WDR79 Polyclonal specifically detects WDR79 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: WDR79
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FLJ10385, TCAB1WDR79telomerase Cajal body protein 1, WD repeat containing, antisense to TP53, WD repeat domain 79, WD repeat-containing protein 79, WD40 protein Wrap53, WD40 repeat-containing protein encoding RNA antisense to p53, WD-encoding RNA antisense to p53
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: WRAP53
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 55135
• Target Species: Human
• Isotype: IgG

For Research Use Only