Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR8 Polyclonal specifically detects WDR8 in Human samples. It is validated for Western Blot.Specifications
WDR8 | |
Polyclonal | |
Rabbit | |
Q9P2S5 | |
49856 | |
Synthetic peptides corresponding to WDR8(WD repeat domain 8) The peptide sequence was selected from the middle region of WDR8. Peptide sequence GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ20430, MGC99569, WD repeat domain 8, WD repeat-containing protein 8 | |
WRAP73 | |
IgG | |
51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title