Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WDR89 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WDR89 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WDR89 Polyclonal specifically detects WDR89 in Human samples. It is validated for Western Blot.Specifications
WDR89 | |
Polyclonal | |
Rabbit | |
Q96FK6 | |
112840 | |
Synthetic peptides corresponding to WDR89(WD repeat domain 89) The peptide sequence was selected from the middle region of WDR89. Peptide sequence TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C14orf150, MGC9907, WD repeat domain 89, WD repeat-containing protein 89 | |
WDR89 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title