WDR90 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257617

Catalog No. NBP257617

Description

WDR90 Polyclonal specifically detects WDR90 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: WDR90
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, chromosome 16 open reading frame 15, chromosome 16 open reading frame 17, chromosome 16 open reading frame 18, chromosome 16 open reading frame 19, FLJ36483, FLJ44660, KIAA1924chromosome 16 open reading frame 16, WD repeat domain 90, WD repeat-containing protein 90
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 197335
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: WDR90
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFHSLEPWAQLEASDIHTAAAGTHVLTHESAEVPVARTGSCEGFLPDPVLRLKGVIGFGGHGTRQALWTPDGAAVVYPCHAVIVVLLV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only