WDSUB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155073

Catalog No. NBP155073

Description

WDSUB1 Polyclonal specifically detects WDSUB1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: WDSUB1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ36175,2610014F08Rik, SAM and U-box domain-containing protein 1, UBOX6, WD repeat, SAM and U-box domain containing 1, WD repeat, sterile alpha motif and U-box domain containing 1, WDSAM1
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N9V3
• Gene Symbols: WDSUB1
• Immunogen: Synthetic peptides corresponding to WDSUB1(WD repeat, sterile alpha motif and U-box domain containing 1) The peptide sequence was selected from the middle region of WDSUB1. Peptide sequence KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151525
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.