Wee1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25692525UL

Catalog No. NB435435

Description

Wee1 Polyclonal specifically detects Wee1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Wee1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp686I18166, EC 2.7.10.2, FLJ16446, WEE1 homolog (S. pombe), wee1+ (S. pombe) homolog, WEE1+ homolog, WEE1A, Wee1A kinase, WEE1hu, wee1-like protein kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: WEE1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQ
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Checkpoint signaling, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Stem Cell Markers
• Gene ID (Entrez): 7465
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only