Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WFDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | WFDC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WFDC1 Polyclonal specifically detects WFDC1 in Human samples. It is validated for Western Blot.Specifications
WFDC1 | |
Polyclonal | |
Rabbit | |
Q9HC57 | |
58189 | |
Synthetic peptides corresponding to WFDC1 (WAP four-disulfide core domain 1) The peptide sequence was selected from the middle region of WFDC1)(50ug). Peptide sequence VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ps20 growth inhibitor, PS20Prostate stromal protein ps20, WAP four-disulfide core domain 1, WAP four-disulfide core domain 1 homolog, WAP four-disulfide core domain protein 1 | |
WFDC1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title