Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WFDC8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | WFDC8 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
WFDC8 Polyclonal antibody specifically detects WFDC8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
WFDC8 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
C20orf170, dJ461P17.1, WAP8, WFDC8 WAP four-disulfide core domain 8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLVEKCCSHCGLKCMDPR | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Purified | |
RUO | |
PBS (pH 7.2) and 40% Glycerol | |
90199 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title