Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WIF-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | WIF-1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1794920
|
Novus Biologicals
NBP17949120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179491
|
Novus Biologicals
NBP179491 |
100 μL |
Each for $487.50
|
|
|||||
Description
WIF-1 Polyclonal specifically detects WIF-1 in Human samples. It is validated for Western Blot.Specifications
| WIF-1 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Wnt Signaling Pathway | |
| WIF-1, WNT inhibitory factor 1 | |
| WIF1 | |
| IgG | |
| 38 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_009122 | |
| 11197 | |
| Synthetic peptide directed towards the N terminal of human WIF1The immunogen for this antibody is WIF1. Peptide sequence RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title