Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WIPF3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen WIPF3
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB432644
SDP
View Documents
Novus Biologicals
NBP18438825UL
25 μL
Each for $382.00
Only null left
Add to Cart
 
NBP184388
SDP
View Documents
Novus Biologicals
NBP184388
0.1 mL
Each for $610.00
Only null left
Add to Cart
 
Description

Description

WIPF3 Polyclonal specifically detects WIPF3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

WIPF3
Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
644150
This antibody was developed against Recombinant Protein corresponding to amino acids:QIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTISGPLIPPASPRLGNTS
Primary
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Polyclonal
Rabbit
Human
WAS/WASL interacting protein family, member 3
WIPF3
IgG
Affinity Purified
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Videos
SDS
Documents

Documents

Product Certifications

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.