WIPI2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431055	Novus Biologicals NBP18887925UL	25 μL
NBP188879	Novus Biologicals NBP188879	0.1 mL

Description

WIPI2 Polyclonal specifically detects WIPI2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: WIPI2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 26100
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984, WD repeat domain phosphoinositide-interacting protein 2, WD repeat domain, phosphoinositide interacting 2, WD40 repeat protein interacting with phosphoinositides 2, WIPI-2, WIPI49-like protein 2
• Gene Symbols: WIPI2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human WIPI2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only