WISP-1/CCN4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186570

Catalog No. NBP186570

Description

WISP-1/CCN4 Polyclonal specifically detects WISP-1/CCN4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: WISP-1/CCN4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Gene Alias: CCN family member 4, CCN4WISP1tc, WISP-1, WISP1c, WISP1i, WNT1 induced secreted protein 1, Wnt-1 inducible signaling pathway protein 1, WNT1 inducible signaling pathway protein 1, wnt-1 signaling pathway protein 1, Wnt-1-induced secreted protein, WNT1-inducible-signaling pathway protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CCN4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAF
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Cancer, DNA Repair
• Gene ID (Entrez): 8840
• Target Species: Human
• Isotype: IgG

For Research Use Only