Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WNK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | WNK3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
WNK3 Polyclonal specifically detects WNK3 in Human samples. It is validated for Western Blot.Specifications
WNK3 | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3 | |
WNK3 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9BYP7 | |
65267 | |
Synthetic peptides corresponding to WNK3(WNK lysine deficient protein kinase 3) The peptide sequence was selected from the N terminal of WNK3. Peptide sequence WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title