Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt-10b Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$377.03 - $728.30
Specifications
| Antigen | Wnt-10b |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Wnt-10b Polyclonal specifically detects Wnt-10b in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Wnt-10b | |
| Polyclonal | |
| Rabbit | |
| Wnt Signaling Pathway | |
| protein Wnt-10b, Protein Wnt-12, SHFM6WNT-10B protein, wingless-type MMTV integration site family, member 10B, WNT12, WNT-12 | |
| WNT10B | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7480 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title