Wnt-3a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174183

Catalog No. NBP174183

Description

Wnt-3a Polyclonal specifically detects Wnt-3a in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Wnt-3a
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC119418, MGC119419, MGC119420, protein Wnt-3a, wingless-type MMTV integration site family, member 3A
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 86%; Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 2.5 ug/ml, Immunohistochemistry-Paraffin 2.5 ug/ml
• Gene Accession No.: P27467
• Gene Symbols: WNT3A
• Immunogen: Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 89780
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

For Research Use Only