Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Wnt-3a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174183
Description
Wnt-3a Polyclonal specifically detects Wnt-3a in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Wnt-3a | |
Polyclonal | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
MGC119418, MGC119419, MGC119420, protein Wnt-3a, wingless-type MMTV integration site family, member 3A | |
Rabbit | |
38 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Rabbit: 86%; Zebrafish: 75%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 2.5 ug/ml, Immunohistochemistry-Paraffin 2.5 ug/ml | |
P27467 | |
WNT3A | |
Synthetic peptides corresponding to the C terminal of Wnt3a. Immunizing peptide sequence IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA. | |
Affinity purified | |
RUO | |
89780 | |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction