Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ WRCH1 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA569127
Description
This target displays homology in the following species: Cow: 100%; Dog: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 100%; Rat: 79%; Zebrafish: 93%.
This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
Specifications
WRCH1 | |
Polyclonal | |
Unconjugated | |
Rhou | |
2310026M05Rik; AI182090; ARHU; CDC42L1; CDC42-like GTPase 1; G28K; GTP-binding protein like 1; GTP-binding protein SB128; GTP-binding protein-like 1; hG28K; LOC678766; LOW QUALITY PROTEIN: rho-related GTP-binding protein RhoU; mG28K; ras homolog family member U; ras homolog gene family, member U; ras-like gene family member U; Ras-like protein member U; rho GTPase-like protein ARHU; Rho-related GTP-binding protein RhoU; rho-related GTP-binding protein RhoU-like; RHOU; Ryu GTPase; SB128; similar to ras homolog gene family, member U; Wnt1 responsive Cdc42 homolog; wnt-1 responsive Cdc42 homolog 1; WRCH1; WRCH-1 | |
Rabbit | |
Affinity Chromatography | |
RUO | |
69581 | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
Western Blot | |
0.5 mg/mL | |
PBS with 2% sucrose and 0.09% sodium azide | |
Q9EQT3 | |
Rhou | |
synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41-90). | |
100 μL | |
Primary | |
Mouse | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction