Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ WRCH1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA569127
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA569127 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA569127 Supplier Invitrogen™ Supplier No. PA569127
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

This target displays homology in the following species: Cow: 100%; Dog: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 100%; Rat: 79%; Zebrafish: 93%.

This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
TRUSTED_SUSTAINABILITY

Specifications

Antigen WRCH1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 2% sucrose and 0.09% sodium azide
Gene Rhou
Gene Accession No. Q9EQT3
Gene Alias 2310026M05Rik; AI182090; ARHU; CDC42L1; CDC42-like GTPase 1; G28K; GTP-binding protein like 1; GTP-binding protein SB128; GTP-binding protein-like 1; hG28K; LOC678766; LOW QUALITY PROTEIN: rho-related GTP-binding protein RhoU; mG28K; ras homolog family member U; ras homolog gene family, member U; ras-like gene family member U; Ras-like protein member U; rho GTPase-like protein ARHU; Rho-related GTP-binding protein RhoU; rho-related GTP-binding protein RhoU-like; RHOU; Ryu GTPase; SB128; similar to ras homolog gene family, member U; Wnt1 responsive Cdc42 homolog; wnt-1 responsive Cdc42 homolog 1; WRCH1; WRCH-1
Gene Symbols Rhou
Host Species Rabbit
Immunogen synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41-90).
Purification Method Affinity Chromatography
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 69581
Target Species Mouse
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.