Invitrogen™ WRCH1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA569127

Catalog No. PIPA569127

Description

This target displays homology in the following species: Cow: 100%; Dog: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 79%; Rabbit: 100%; Rat: 79%; Zebrafish: 93%.

This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.

Specifications

• Antigen: WRCH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Rhou
• Gene Alias: 2310026M05Rik; AI182090; ARHU; CDC42L1; CDC42-like GTPase 1; G28K; GTP-binding protein like 1; GTP-binding protein SB128; GTP-binding protein-like 1; hG28K; LOC678766; LOW QUALITY PROTEIN: rho-related GTP-binding protein RhoU; mG28K; ras homolog family member U; ras homolog gene family, member U; ras-like gene family member U; Ras-like protein member U; rho GTPase-like protein ARHU; Rho-related GTP-binding protein RhoU; rho-related GTP-binding protein RhoU-like; RHOU; Ryu GTPase; SB128; similar to ras homolog gene family, member U; Wnt1 responsive Cdc42 homolog; wnt-1 responsive Cdc42 homolog 1; WRCH1; WRCH-1
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 69581
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Form: Liquid

• Applications: Western Blot
• Concentration: 0.5 mg/mL
• Formulation: PBS with 2% sucrose and 0.09% sodium azide
• Gene Accession No.: Q9EQT3
• Gene Symbols: Rhou
• Immunogen: synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI (aa 41-90).
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov