Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
WSB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | WSB2 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
WSB2 Polyclonal antibody specifically detects WSB2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
WSB2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS (pH 7.2), 40% Glycerol | |
55884 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
CS box-containing WD protein, MGC10210, SBA2, WD repeat and SOCS box containing 2, WD repeat and SOCS box containing protein 2, WD repeat and SOCS box-containing 2, WD repeat and SOCS box-containing protein 2, WSB-2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLL | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title