XPG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156397

Catalog No. NBP156397

Description

XPG Polyclonal specifically detects XPG in Human samples. It is validated for Western Blot.

Specifications

• Antigen: XPG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC 3.1, ERCM2, excision repair cross-complementing rodent repair deficiency, complementationgroup 5, excision repair protein, xeroderma pigmentosum complementation group G protein, Xeroderma pigmentosum group G-complementing protein, xeroderma pigmentosum, complementation group G, XPGC, XPG-complementing protein, XPGUVDR
• Host Species: Rabbit
• Molecular Weight of Antigen: 133 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 2073
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P28715
• Gene Symbols: ERCC5
• Immunogen: Synthetic peptide corresponding to the N terminal of ERCC5(excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G (Cockayne syndrome))) Peptide sequence NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Pig: 92%; Xenopus: 85%; Bovine: 85%; Canine: 85%; Equine: 85%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG