Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. XPG Antibody, Novus Biologicals™

XPG Antibody, Novus Biologicals™
SDP

Catalog No. NBP156397 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156397 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156397 Supplier Novus Biologicals Supplier No. NBP156397
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

XPG Polyclonal specifically detects XPG in Human samples. It is validated for Western Blot.

Specifications

Antigen XPG
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P28715
Gene Alias COFS3, DNA excision repair protein ERCC-5, DNA repair protein complementing XP-G cells, EC 3.1, ERCM2, excision repair cross-complementing rodent repair deficiency, complementationgroup 5, excision repair protein, xeroderma pigmentosum complementation group G protein, Xeroderma pigmentosum group G-complementing protein, xeroderma pigmentosum, complementation group G, XPGC, XPG-complementing protein, XPGUVDR
Gene Symbols ERCC5
Host Species Rabbit
Immunogen Synthetic peptide corresponding to the N terminal of ERCC5(excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G (Cockayne syndrome))) Peptide sequence NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 133 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, DNA Repair, Nucleotide Excision Repair
Primary or Secondary Primary
Gene ID (Entrez) 2073
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Pig: 92%; Xenopus: 85%; Bovine: 85%; Canine: 85%; Equine: 85%; Chicken: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.