Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XRRA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | XRRA1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
XRRA1 Polyclonal specifically detects XRRA1 in Human samples. It is validated for Western Blot.Specifications
XRRA1 | |
Polyclonal | |
Rabbit | |
X-ray radiation resistance associated 1 | |
XRRA1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
143570 | |
Synthetic peptides corresponding to XRRA1 (X-ray radiation resistance associated 1) The peptide sequence was selected from the N terminal of XRRA1)(50ug). Peptide sequence MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title