Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XTP3TPA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | XTP3TPA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15533520
|
Novus Biologicals
NBP15533520UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155335
|
Novus Biologicals
NBP155335 |
100 μL |
Each for $487.50
|
|
|||||
Description
XTP3TPA Polyclonal specifically detects XTP3TPA in Human samples. It is validated for Western Blot.Specifications
| XTP3TPA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q9H773 | |
| 79077 | |
| Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF. | |
| Primary | |
| 19 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| dCTP pyrophosphatase 1, dCTPase 1, Deoxycytidine-triphosphatase 1, EC 3.6.1.12, MGC5627, RS21C6XTP3-transactivated gene A protein, XTP3TPACDA03, XTP3-transactivated protein A | |
| DCTPP1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title