YIF1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255325

Catalog No. NBP255325

Description

YIF1B Polyclonal specifically detects YIF1B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: YIF1B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FinGER8, FLJ23477, FLJ50074, MGC39135, protein YIF1B, Yip1 interacting factor homolog B (S. cerevisiae), YIP1-interacting factor homolog B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: YIF1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PHQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITKLKYYFAVDTMYVGRKLGLLFFPYLHQDWEVQYQQ
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 90522
• Target Species: Human
• Isotype: IgG

For Research Use Only