Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZADH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZADH1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZADH1 Polyclonal specifically detects ZADH1 in Human samples. It is validated for Western Blot.Specifications
ZADH1 | |
Polyclonal | |
Rabbit | |
Q8N8N7 | |
145482 | |
Synthetic peptides corresponding to ZADH1 The peptide sequence was selected from the middle region of ZADH1. Peptide sequence ILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGIQEKGHITAGSNKT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp686P10120, EC 1.3.1.48, FLJ39091, FLJ99229,15-oxoprostaglandin 13-reductase, PGR2, PRG-2, prostaglandin reductase 2, ZADH115-oxoprostaglandin-delta13-reductase, zinc binding alcohol dehydrogenase domain containing 1, zinc binding alcohol dehydrogenase, domain containing 1, Zinc-binding alcohol dehydrogenase domain-containing protein 1 | |
PTGR2 | |
IgG | |
38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title