ZBTB11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180327

Catalog No. NBP180327

Description

ZBTB11 Polyclonal specifically detects ZBTB11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZBTB11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ13426, MGC133303, zinc finger and BTB domain containing 11, zinc finger and BTB domain-containing protein 11, ZNF913, ZNF-U69274
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27107
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_055230
• Gene Symbols: ZBTB11
• Immunogen: Synthetic peptide directed towards the N terminal of human ZBTB11. Peptide sequence SSEESYRAILRYLTNEREPYAPGTEGNVKRKIRKAAACYVVRGGTLYYQR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only