Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB26 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZBTB26 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZBTB26 Polyclonal specifically detects ZBTB26 in Human samples. It is validated for Western Blot.Specifications
ZBTB26 | |
Polyclonal | |
Rabbit | |
NP_065975 | |
57684 | |
Synthetic peptide directed towards the middle region of human ZBTB26. Peptide sequence QIVKVESIGDVSEVRSKKDQNQFISSEPTALHSSEPQHSLINSTVENRVS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1572, zinc finger and BTB domain containing 26, zinc finger and BTB domain-containing protein 26, Zinc finger protein 481bioref, zinc finger protein 483, Zinc finger protein Bioref, ZNF481 | |
ZBTB26 | |
IgG | |
50 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title