Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZBTB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180367
|
Novus Biologicals
NBP180367 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZBTB3 Polyclonal specifically detects ZBTB3 in Human samples. It is validated for Western Blot.Specifications
| ZBTB3 | |
| Polyclonal | |
| Rabbit | |
| NP_079060 | |
| 79842 | |
| Synthetic peptide directed towards the N terminal of human ZBTB3. Peptide sequence MLREFSKWGVEASPGKAWERKRSLLRGAVGRYRGATGGDLFWAPFPSWGT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ23392, zinc finger and BTB domain containing 3, zinc finger and BTB domain-containing protein 3 | |
| ZBTB3 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title