Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB8A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP188375
Description
ZBTB8A Polyclonal specifically detects ZBTB8A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZBTB8A | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
BOZ-F1, BOZF1BTB/POZ and zinc-finger domains factor on chromosome 1, BTB/POZ and zinc-finger domain-containing factor, FLJ90065, MGC17919, ZBTB8, zinc finger and BTB domain containing 8, zinc finger and BTB domain containing 8A, zinc finger and BTB domain-containing protein 8A, ZNF916A | |
Rabbit | |
Affinity Purified | |
RUO | |
653121 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ZBTB8A | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction