Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCCHC12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ZCCHC12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15480820
![]() |
Novus Biologicals
NBP15480820UL |
20 μL |
Each for $206.00
|
|
|||||
NBP154808
![]() |
Novus Biologicals
NBP154808 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZCCHC12 Polyclonal specifically detects ZCCHC12 in Human samples. It is validated for Western Blot.Specifications
| ZCCHC12 | |
| Polyclonal | |
| Rabbit | |
| Q6PEW1 | |
| 170261 | |
| Synthetic peptides corresponding to ZCCHC12(zinc finger, CCHC domain containing 12) The peptide sequence was selected from the N terminal of ZCCHC12. Peptide sequence AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ16123, SIZN, SIZN12810028A01Rik, Smad-interacting zinc finger protein 1, zinc finger CCHC domain-containing protein 12, zinc finger, CCHC domain containing 12 | |
| ZCCHC12 | |
| IgG | |
| 45 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title