Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCCHC12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | ZCCHC12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15480820
|
Novus Biologicals
NBP15480820UL |
20 μL |
Each for $204.00
|
|
|||||
NBP154808
|
Novus Biologicals
NBP154808 |
100 μL |
Each for $482.50
|
|
|||||
Description
ZCCHC12 Polyclonal specifically detects ZCCHC12 in Human samples. It is validated for Western Blot.Specifications
ZCCHC12 | |
Polyclonal | |
Rabbit | |
Q6PEW1 | |
170261 | |
Synthetic peptides corresponding to ZCCHC12(zinc finger, CCHC domain containing 12) The peptide sequence was selected from the N terminal of ZCCHC12. Peptide sequence AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ16123, SIZN, SIZN12810028A01Rik, Smad-interacting zinc finger protein 1, zinc finger CCHC domain-containing protein 12, zinc finger, CCHC domain containing 12 | |
ZCCHC12 | |
IgG | |
45 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title