ZCCHC17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157131

Catalog No. NBP157131

Description

ZCCHC17 Polyclonal specifically detects ZCCHC17 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZCCHC17
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HSPC251, nucleolar protein of 40 kDa, Pnn-interacting nucleolar protein, pNO40nucleolar protein 40, PS1D protein, PS1DRP11-266K22.1, putative S1 RNA binding domain protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17, zinc finger, CCHC domain containing 17
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Bovine: 92%; Pig: 85%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NP64
• Gene Symbols: ZCCHC17
• Immunogen: Synthetic peptides corresponding to ZCCHC17(zinc finger, CCHC domain containing 17) The peptide sequence was selected from the middle region of ZCCHC17. Peptide sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 51538
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.