Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCCHC17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | ZCCHC17 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZCCHC17 Polyclonal specifically detects ZCCHC17 in Human samples. It is validated for Western Blot.Specifications
ZCCHC17 | |
Polyclonal | |
Rabbit | |
Q9NP64 | |
51538 | |
Synthetic peptides corresponding to ZCCHC17(zinc finger, CCHC domain containing 17) The peptide sequence was selected from the middle region of ZCCHC17. Peptide sequence CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
HSPC251, nucleolar protein of 40 kDa, Pnn-interacting nucleolar protein, pNO40nucleolar protein 40, PS1D protein, PS1DRP11-266K22.1, putative S1 RNA binding domain protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17, zinc finger, CCHC domain containing 17 | |
ZCCHC17 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title