Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCCHC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZCCHC3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZCCHC3 Polyclonal specifically detects ZCCHC3 in Human samples. It is validated for Western Blot.Specifications
ZCCHC3 | |
Polyclonal | |
Rabbit | |
NP_149080 | |
85364 | |
Synthetic peptide directed towards the middle region of human ZCCHC3The immunogen for this antibody is ZCCHC3. Peptide sequence RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C20orf99, chromosome 20 open reading frame 99, dJ1103G7.7, MGC104290, zinc finger CCHC domain-containing protein 3, zinc finger, CCHC domain containing 3 | |
ZCCHC3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title