Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCCHC3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZCCHC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179404
|
Novus Biologicals
NBP179404 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZCCHC3 Polyclonal specifically detects ZCCHC3 in Human samples. It is validated for Western Blot.Specifications
| ZCCHC3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf99, chromosome 20 open reading frame 99, dJ1103G7.7, MGC104290, zinc finger CCHC domain-containing protein 3, zinc finger, CCHC domain containing 3 | |
| ZCCHC3 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_149080 | |
| 85364 | |
| Synthetic peptide directed towards the middle region of human ZCCHC3The immunogen for this antibody is ZCCHC3. Peptide sequence RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title