Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZCRB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310542100UL
Description
ZCRB1 Polyclonal specifically detects ZCRB1 in Human samples. It is validated for Western Blot.Specifications
ZCRB1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MADP-1, MADP1U11/U12 snRNP 31 kDa protein, MGC26805, RBM36, U11/U12 small nuclear ribonucleoprotein 31 kDa protein, U11/U12 snRNP 31K, U11/U12-31K, ZCCHC19, zinc finger CCHC-type and RNA binding motif 1, zinc finger CCHC-type and RNA-binding motif-containing protein 1 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZCRB1 (NP_149105). Peptide sequence MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
85437 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction