ZDHHC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438463	Novus Biologicals NBP21353925UL	25ul
NBP213539	Novus Biologicals NBP213539	0.1 mL

Description

ZDHHC1 Polyclonal specifically detects ZDHHC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: ZDHHC1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 29800
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HKLTTYEYIVQHRPPQEAKGVHRELESCPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWD
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: C16orf1, DHHC domain-containing cysteine-rich protein 1, DHHC-1, DHHC-domain-containing cysteine-rich protein, EC 2.3.1.-, HSU90653, probable palmitoyltransferase ZDHHC1, Zinc finger DHHC domain-containing protein 1, Zinc finger protein 377, zinc finger, DHHC domain containing 1, zinc finger, DHHC-type containing 1, ZNF377chromosome 16 open reading frame 1
• Gene Symbols: ZDHHC1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only