Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC11/ZDHHC11B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Applications | Western Blot |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179327
|
Novus Biologicals
NBP179327 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZDHHC11 Polyclonal specifically detects ZDHHC11 in Rat samples. It is validated for Western Blot.Specifications
Western Blot | |
Unconjugated | |
RUO | |
The immunogen for this antibody is Zdhhc11 (NP_001034431). Peptide sequence TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC. | |
Primary |
Polyclonal | |
Rabbit | |
P0C7U3 | |
IgG | |
42 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title