ZDHHC17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB407318	Novus Biologicals NBP18174825UL	25 μL
NBP181748	Novus Biologicals NBP181748	0.1 mL

Description

ZDHHC17 Polyclonal specifically detects ZDHHC17 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZDHHC17
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 23390
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RKEGFNTKMADGPDEYDTEAGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKATQYGIYERCRELVEAGYDVR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DHHC-17, EC 2.3.1, EC 2.3.1.-, HIP14HIP-14, huntingtin interacting protein 14, huntingtin interacting protein 3, Huntingtin interacting protein H, Huntingtin yeast partner H, Huntingtin-interacting protein 14, Huntingtin-interacting protein 3, Huntingtin-interacting protein H, HYPHHIP-3, KIAA0946HIP3, palmitoyltransferase ZDHHC17, Putative MAPK-activating protein PM11, Putative NF-kappa-B-activating protein 205, Zinc finger DHHC domain-containing protein 17, zinc finger, DHHC domain containing 17, zinc finger, DHHC-type containing 17
• Gene Symbols: ZDHHC17
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only