Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC19 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ZDHHC19 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP160120UL
|
Novus Biologicals
NBP16010020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP160100
|
Novus Biologicals
NBP160100 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZDHHC19 Polyclonal specifically detects ZDHHC19 in Human samples. It is validated for Western Blot.Specifications
| ZDHHC19 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DHHC domain containing 19, DHHC19, EC 2.3.1.-, zinc finger, DHHC-type containing 19 | |
| ZDHHC19 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B3KVI1 | |
| 131540 | |
| Synthetic peptides corresponding to ZDHHC19(zinc finger, DHHC-type containing 19) The peptide sequence was selected from the middle region of ZDHHC19. Peptide sequence AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title