Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZDHHC2 Antibody, Novus Biologicals™

ZDHHC2 Antibody, Novus Biologicals™
SDP

Catalog No. NB405001 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25 ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405001 25 ul
NBP213541 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405001 Supplier Novus Biologicals Supplier No. NBP21354125UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

ZDHHC2 Polyclonal specifically detects ZDHHC2 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ZDHHC2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DHHC2, DHHC-2, EC 2.3.1, EC 2.3.1.-, palmitoyltransferase ZDHHC2, Ream, REC, Reduced expression associated with metastasis protein, Reduced expression in cancer protein, Zinc finger DHHC domain-containing protein 2, Zinc finger protein 372, zinc finger, DHHC domain containing 2, zinc finger, DHHC-type containing 2, ZNF372rec
Gene Symbols ZDHHC2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI
Purification Method Affinity Purified
Quantity 25 ul
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51201
Test Specificity Specificity of human ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.