Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZEB2 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human ZEB2.

Manufacturer:  Abnova Corporation PAB29548

Catalog No. 89-935-125


Add to cart

Description

Description

The SMADIP1 gene (also known as SIP1) is a member of the delta-EF1 (ZEB1; MIM 189909)/Zfh1 family of 2-handed zinc finger/homeodomain proteins. SMADIP1 interacts with receptor-mediated, activated full-length SMADs (see MIM 605568) (Verschueren et al., 1999 [PubMed 10400677]).[supplied by OMIM]

Sequence: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Specifications

Specifications

ZEB2
Unconjugated
Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user.
Liquid
ZEB2
Recombinant protein corresponding to human ZEB2.
Antigen affinity purification
RUO
Primary
9839
Immunohistochemistry (PFA fixed)
Rabbit polyclonal antibody raised against recombinant human ZEB2.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
KIAA0569/SIP-1/SIP1/SMADIP1/ZFHX1B
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit