Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFAND3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP182262
Description
ZFAND3 Polyclonal specifically detects ZFAND3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ZFAND3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50 | |
AN1-type zinc finger protein 3, FLJ17799, testis expressed sequence 27, Testis-expressed sequence 27, TEX27FLJ13222, zinc finger, AN1-type domain 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
ZFAND3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MGDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLFSEETTSDNNNTSITTPTLSP | |
0.1 mL | |
Signal Transduction | |
60685 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction